SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058342|ref|YP_001790691.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058342|ref|YP_001790691.1|
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily CheY-like 5.12e-41
Family CheY-related 0.00011
Further Details:      
 
Domain Number 2 Region: 129-225
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.54e-29
Family PhoB-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058342|ref|YP_001790691.1|
Sequence length 245
Comment two component transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MGRILVVEDEPAIAELISMNLRHAGYDPHTVGSAGEAHEAVRDALPDLVILDWMLPGESG
VSLARRWRADARTRELSIIMLTARSSEQDMVQGLDAGADDYLSKPFSTAELLARIRAVLR
RKLPEALEAAVEVGPLRLDPAAHRVFHQHDEVTLGPTEFRLLRFLMTYPERVHSRGQLLD
RVWGDHVFIEERTVDVHIKRLRGVLAPYGCAELIETVRGAGYRLARKLPTAVPGGGPAGA
DVPMR
Download sequence
Identical sequences B1XY25
WP_012346687.1.27902 gi|171058342|ref|YP_001790691.1| 395495.Lcho_1659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]