SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171058386|ref|YP_001790735.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058386|ref|YP_001790735.1|
Domain Number 1 Region: 30-265
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.21e-78
Family Pseudouridine synthase II TruB 0.0000013
Further Details:      
 
Weak hits

Sequence:  gi|171058386|ref|YP_001790735.1|
Domain Number - Region: 264-320
Classification Level Classification E-value
Superfamily PUA domain-like 0.0159
Family PUA domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058386|ref|YP_001790735.1|
Sequence length 339
Comment tRNA pseudouridine synthase B [Leptothrix cholodnii SP-6]
Sequence
MNAVLDAQANAATGARRTDAPTRVRLPRRPVHGVLLLDKPIGWTSNDALQKVKNLLRAEK
AGHTGTLDPLATGLLPLCFGAATKFSQVSLEADKAYRATVRLGQRTEGGDREGAVIEERP
VQVDRALIEAACARLTGKLMQMPPMHSALKHQGKALYEYARAGITVERAPREVTLHSIDI
VEWQAVTPEHLVIDVSCSKGTYIRTLAEDLGELLGCGAHLAALQRTGSGPAQLADAISLE
ALLACTEAQREARLLPPDVLLRHWPALHLQADDAGRFLSGMRRRVDHPDANDVRVYGPHG
QTFLGSAHITAGELIADRLLSPLEVQAQLPVAATPTLTP
Download sequence
Identical sequences B1XY69
WP_012346731.1.27902 395495.Lcho_1703 gi|171058386|ref|YP_001790735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]