SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058447|ref|YP_001790796.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058447|ref|YP_001790796.1|
Domain Number 1 Region: 207-460
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.59e-69
Family Leukotriene A4 hydrolase catalytic domain 0.0019
Further Details:      
 
Domain Number 2 Region: 9-194
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.75e-43
Family Leukotriene A4 hydrolase N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171058447|ref|YP_001790796.1|
Sequence length 897
Comment aminopeptidase N [Leptothrix cholodnii SP-6]
Sequence
MREGTSTVVRREDYTAPSHWIRTVDLTFDLDPAKTLVISRMSVEPNTERPGQPLRLDGED
ITLTRVLVNGESISFRFEGQQLVLEHLPAEPFSLEIRNTCAPEKNTELSGLYTSGGSFFT
QCEAQGFRRITYFLDRPDVMALYTVTLRANAKAYPVLLSNGNRVEHGTLDNGRHFATWVD
PHPKPSYLFALVAGALVCREQCVRSRSGKDHLLQVYVRAGDLDKTEHAMNSLIASVVWDE
ARFGLSLDLERFMIVAVSDFNMGAMENKGLNIFNTKFVLANPATATDTDYANIEAVVGHE
YFHNWTGNRVTCRDWFQLSLKEGLTVYRDQEFSQDMAGVASARAVKRIEDVRQLRQMQFP
EDAGPMAHPVRPEQYQAIDNFYTTTVYEKGAEVVRMMATLVGREGFRRGMDLYFARHDGQ
AVTCDDFAQAIADANPGSDLATRLDSFKRWYSQAGTPRVSASGHYDPGAGTYTVTLAQHT
PATPGQPVKLPFVIPVAMGLLDSDGRPLLLQLQGESQYGGTERVLVLEQANQAFVFTGLY
GLTGEPVPSLLRGFSAPVILEWAATERQLFTLLHHDTDPTNRWEAAQRLGLLRLMGAVQS
GRPLQLDAAYIDAQRAVLRDPSLDAAFKDLLLTPPSEGYVAEQLAAAGVPVDPPAIHAAR
EAMRSQLAQALFDDWVWAFEAHHDNGAYRPDPVSTGRRALANLALAHLVLDAGRSGDPVW
PGRAYQRVQDAGNFTDRQGALIALLGAHHALAELALARVHAQFKHEALVIDRWFALQAGA
PERDGQVFQRIKTLVHHPDFLVRNPNRARSVLTTLFHLNPSALHRADAAGYVFWAEKVVE
VDAFNPQLAARLARGLDRWRVLAEPYRSAAHEALCRVAARTELSPDTREIVGRSLAD
Download sequence
Identical sequences B1XZ12
WP_012346792.1.27902 395495.Lcho_1764 gi|171058447|ref|YP_001790796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]