SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058465|ref|YP_001790814.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058465|ref|YP_001790814.1|
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily CheY-like 1.07e-30
Family CheY-related 0.00096
Further Details:      
 
Domain Number 2 Region: 134-199
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 3.33e-19
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058465|ref|YP_001790814.1|
Sequence length 214
Comment two component LuxR family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MRIVLVDDHALVREGVRALLASQPALEVVGEAAQADEALLRVAELQPDLVLMDIGMKHTN
GIHLTAELQRLHPGLAVLMLSMYDNPEYVHQALQAGARGYVLKDGPSSEIFAAIEAIGAG
GNYLSTQLTRAAGARTDDPRPLLSERESEILNGLARGLSSKQIAAQFDLSVRTVETHRQN
IRRKLKIAGQAELIRYAVERCRTHGDAPGGDPPR
Download sequence
Identical sequences B1XZ30
gi|171058465|ref|YP_001790814.1| 395495.Lcho_1782 WP_012346810.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]