SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058513|ref|YP_001790862.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058513|ref|YP_001790862.1|
Domain Number 1 Region: 29-247
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 1.26e-64
Family GTP cyclohydrolase I 0.0000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058513|ref|YP_001790862.1|
Sequence length 250
Comment GTP cyclohydrolase I [Leptothrix cholodnii SP-6]
Sequence
MTTHHSLPILAAERGLAVQETDDSGVPVSVRIRERIKAARQRFHANDNIAEFIRPGELEA
LLDEVSGKMSAVLSSLVIDTESDHNTQDTARRVAKMYLKEVFRGRYVEQPPVTEFPNVER
LNELMIVGPVTVRSACSHHLCPIVGKLWIGVMPNEHSNLIGLSKYARLAEWIMSRPQIQE
EAVTQVADLLQDKMQPDGLAVVMEADHFCMSWRGVKDMDSKMINSVMRGSFLKDPNLRRE
FLSLLQHKKT
Download sequence
Identical sequences B1XZX0
WP_012346858.1.27902 395495.Lcho_1830 gi|171058513|ref|YP_001790862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]