SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058582|ref|YP_001790931.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058582|ref|YP_001790931.1|
Domain Number 1 Region: 218-374
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.43e-57
Family RelA/SpoT domain 0.000012
Further Details:      
 
Domain Number 2 Region: 33-216
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.85e-39
Family HD domain 0.00028
Further Details:      
 
Domain Number 3 Region: 425-489
Classification Level Classification E-value
Superfamily TGS-like 3.49e-18
Family TGS domain 0.038
Further Details:      
 
Domain Number 4 Region: 681-757
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000599
Family AF1403 N-terminal domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058582|ref|YP_001790931.1|
Sequence length 758
Comment (p)ppGpp synthetase I SpoT/RelA [Leptothrix cholodnii SP-6]
Sequence
MKTTRLDVGAESASPILQLADAVGTAGQPDAGQETERLERARAFAVPLLSGHRFDTGEDA
LEHADGVAQILKSVGAAPSMQAAVYLVYAGDFLTDPETVVSQAFGPSYASLVTHTRKLVK
LQRSARDALLEETDQEVLAEQLERVRKMLLAFSHDLRVVLLRLASRLQTLRFHAASRTPC
PRALARESQQVFAPLANRLGIWQIKWELEDLAFRFLQPEQYKRIARLLDEKRVERETGIE
RAREHLAQALAQAGVQAQVQGRPKHIYSIWKKMQGKSLDFSRVFDVSALRVIVADVRDCY
AALSRVHELWHALPDEFDDYIARPKANGYQSLHTVVLDDEQRPFEIQIRTREMHEHAESG
VAAHWAYKEAGSKGYAGVSAAGDFEDRVALARRAVLHQLLAWERDFAGQSAAQAAGLGGQ
GAGAGFFEDRIYVLTPQGSVIELPAGATAIDFAYQLHTDLGHRCRGARVDGALVPLITPL
KSGQTVEIVAAKEGGPSLDWLNPQLGYLQSHRARAKARAWFNARALQDTVARGREAVDKL
LQREGRTAIKLDELATQLGFRHAEALFEVVGKDEYSLRNIELQLRPPEPVVEDDTPVFKR
SRSHAGGGNGVLVVGVGSLLTQLAHCCRPAPPDVIGGFVTRSKGVAVHRKDCLNFREMVA
RHPERAIPVTWGSQGASDGRNAVYPVNVSVTAVDRQGLLRDISEVFAKEKMNVTGVHTRS
VKGTAWMTFTVEVADSALLAHVLSLVASVNGVRSAQRR
Download sequence
Identical sequences B1Y0Q8
395495.Lcho_1899 gi|171058582|ref|YP_001790931.1| WP_012346927.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]