SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058592|ref|YP_001790941.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058592|ref|YP_001790941.1|
Domain Number 1 Region: 114-284
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.77e-52
Family NadC C-terminal domain-like 0.00000332
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.75e-31
Family NadC N-terminal domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058592|ref|YP_001790941.1|
Sequence length 289
Comment nicotinate-nucleotide pyrophosphorylase [Leptothrix cholodnii SP-6]
Sequence
MTTAARLPADLALNVQIALAEDLGSGDVTALLVDPSQTASARIVSREAAVLCGQAWVDAV
FRALQPGMRIDWAVPEGASVAPDQVVCLLSGSARALLTGERTALNFLQTLSGTATSVRRY
VDAVLGTGTRIVDTRKTLPGLRNAQKYAVVCGGGLNHRIGLYDGILIKENHVSAAGGLRE
AIWQARALGLSVPLMTEAETLAEARIALDEDVDLLLVDDFELDDIRTAVALVREHRACGG
KTLIEYSGGATLETVRALAETGVDRISVGAITKHLRALDLSMRFTASGE
Download sequence
Identical sequences B1Y0R8
gi|171058592|ref|YP_001790941.1| 395495.Lcho_1909 WP_012346937.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]