SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058598|ref|YP_001790947.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058598|ref|YP_001790947.1|
Domain Number 1 Region: 1105-1359
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 5.92e-87
Family Class I glutamine amidotransferases (GAT) 0.0000000588
Further Details:      
 
Domain Number 2 Region: 657-853
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.65e-64
Family PurM N-terminal domain-like 0.000000507
Further Details:      
 
Domain Number 3 Region: 260-464
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 2.86e-55
Family PurM N-terminal domain-like 0.000000255
Further Details:      
 
Domain Number 4 Region: 469-693
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 7.78e-52
Family PurM C-terminal domain-like 0.000000447
Further Details:      
 
Domain Number 5 Region: 863-955,984-1102
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 1.48e-45
Family PurM C-terminal domain-like 0.0000111
Further Details:      
 
Domain Number 6 Region: 30-190
Classification Level Classification E-value
Superfamily PurS-like 2.77e-35
Family FGAM synthase PurL, PurS-like domain 0.0000911
Further Details:      
 
Domain Number 7 Region: 194-259
Classification Level Classification E-value
Superfamily FGAM synthase PurL, linker domain 4.45e-22
Family FGAM synthase PurL, linker domain 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058598|ref|YP_001790947.1|
Sequence length 1360
Comment phosphoribosylformylglycinamidine synthase [Leptothrix cholodnii SP-6]
Sequence
MPGARSAAPQPCGTHRVSSISSSSPQHLTSFEGGNALSAFRALALLPRLQAVSERIAGVS
ARHVHWVWSDSALDRAAHDTLSALLTYGDPAEAVDAGAPASVIVVMPRLGTLSPWASKAT
DIAHNCGLAIHRVERVTEFRISLKSGLLDAFVKKPKALSAEELQACALLLHDRMTESVAF
EREAARHLFDAQPAEPLAHVDVLGQGREALVVANKDFGLALSDDEIDYLVNAFTELKRNP
SDVELMMFAQANSEHCRHKIFNADFTVDGERQPLSMFGMIRNTEKLAPHASVVAYSDNAS
VMPGGPTERWLPQGYTNAPLYAARQETVHVLMKVETHNHPTAISPFPGASTGSGGEIRDE
GSTGRGSKPKAGLAGFSVSNLHLPGTDEPWERAPVGKPEHIASPLQIMTEGPLGAAAFNN
EFGRPNLAGYFRVFEQDVAGLRRGYHKPIMIAGGLGTISEDQTHKLPFGAGTLLIQLGGP
GMRIGMGGGAASSMAAGTNTASLDFDSVQRGNPEIQRRAQEVINHCWALGASNPVVAIHD
VGAGGISNAFPELVDGAGKGATFDIRKVPLEETGLAPKEIWCNESQERYVLAVTPEALPL
FDEMCRRERAPYAVVGVATDDRELVLEEGPGGERPIDMPMDVLLGKPPKMHRDVQRVARS
EQPLQLTGVKLDEVALSVLRHPTVASKRFLITIGDRTVGGLSHRDQMVGPWQVPVADCAV
TLADYAGFRGEAMSMGERTPLAALDAPASGRMAVAEAITNLLAAPMELSRVKLSANWMAA
CGEPGEDAALYDTVRTVGMELCPALGIGIPVGKDSLSMRTRWSDGGHAKQVVAPVSLIVS
AFVTLDDVRGTLTPQLRTDTPAGIDTSLILIDLGNGKNRMGGSMLAQVLGQFGNEVPDLD
DPERLKALVAAINQLRGEGKLLAYHDRSDGGLWASACEMAFAGHVGVSLNVDMLVTEGDG
ITDSRADTGDSKNWAGQVGERRNELTLKALFNEELGVVIQVATAVRNEVLQTLREHGLSK
HSHVIGKTNDRAVVEVWRDAKNVFAAPLQQLHQAWDDVSWRIAAQRDNPACAHSEHAAAG
APDDRGLHVALTFDPTENVAAPFINLTRPKVAILREQGVNSHVEMSYAMAQAGFDSHDVH
MTDLQTGRARLDQFQGFVACGGFSYGDTLGAGEGWARSVLFNPKLAEQFAAFFGRTDTFA
LGVCNGCQMMAALSPIIPGAQHWPKFTRNKSEQFEARLSLVEVLDSPSIFFRGMAGSRLP
IAVAHGEGFADFSQRGDASKVQRAMRFVDHDGAPTEAYPLNPNGSPDGLTSVTTDDGRFT
VLMPHPERVFRNVQMSWTSGDVDARSPWMRMFGNARRWIG
Download sequence
Identical sequences B1Y0S4
395495.Lcho_1915 WP_012346943.1.27902 gi|171058598|ref|YP_001790947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]