SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058601|ref|YP_001790950.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058601|ref|YP_001790950.1|
Domain Number 1 Region: 28-189
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 9.35e-21
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.064
Further Details:      
 
Domain Number 2 Region: 437-561
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000722
Family HD domain 0.037
Further Details:      
 
Domain Number 3 Region: 814-866
Classification Level Classification E-value
Superfamily ACT-like 0.000000000425
Family Glycine cleavage system transcriptional repressor 0.077
Further Details:      
 
Domain Number 4 Region: 704-759
Classification Level Classification E-value
Superfamily ACT-like 0.000000003
Family Glycine cleavage system transcriptional repressor 0.083
Further Details:      
 
Domain Number 5 Region: 197-328
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000000863
Family Glutamine synthase adenylyltransferase GlnE, domain 2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058601|ref|YP_001790950.1|
Sequence length 884
Comment PII uridylyl-transferase [Leptothrix cholodnii SP-6]
Sequence
MPDLHASTLDDVPVQADDKTRPILTIAELRRLMREGRQSLIEQFRTSSASLPAANRLIRQ
LARHVDDVLCQLWEQSGLPKGAALVAVGGYGRAELFPHSDVDVLLLMPHDLPENGAGDRD
GQAQRERVEAFITACWDIGLEIGSSVRTVDECVGEALADVTTQTAMLESRWLCGSKRLFE
QFRRRTCEVLDPADFLVAKTLEMRQRHTKYEDTPYALEPNCKESPGGLRDLQVVRWVAGA
AGLGSSWSEMASKGLITRFEVRQLQRNEGLLKVIRARLHTVAQRREDRLVFDLQTAVAES
FGYTSTAERRASEALMRRYYWAAKAVMQLNQILMLNIEERVNGLQDAAMRPINARFYDRG
GMLEVASDDLYEKDPHAILETFRTYQQTVGIKGLSVRTLRALYNSRELMDGAFRADPENR
RLFMAILQEPRGHTHAFRQMNNTSVLGRYLWVFRRIVGQMQHDLFHVYTVDQHILMVLRN
VRRFFIPEHTHEYPFCSQLAAHWDQPWLLYVAALFHDVAKGRGGDHSDLGAVEVRRFCRD
HGVEREDARLIEFMVKEHLTMSRVAQKEDLSDPEVIQAFAKLVKDPRRLTGLYLLTVADI
RGTSPKVWNAWKGKLLEDLYRSTLRALGGAQPNTDAEIELRKQEARQMLALHSTLPGSQD
ALWQTLDLNYFARHDSGEIAWHARSLKRLADTDRPVVSARLSPVGEGLQVMVYAPDRPDL
FARICGYFDSGQFSIVDARVHTTRAGYALDTFQVITPQFENAYRDLISMVETQLGLALND
DGPLPEPSTGRLSRRVKSFPIAPRVQLRPDERAQRWLLSVSASDRSGLLYRIARVLAQHH
INLQLAKISTLGERVEDTFLVDGSALQHNRSQIEFETQLLDALA
Download sequence
Identical sequences B1Y0S7
395495.Lcho_1918 gi|171058601|ref|YP_001790950.1| WP_012346946.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]