SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058688|ref|YP_001791037.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058688|ref|YP_001791037.1|
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily CheY-like 0.00000213
Family CheY-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058688|ref|YP_001791037.1|
Sequence length 153
Comment hypothetical protein Lcho_2005 [Leptothrix cholodnii SP-6]
Sequence
MKILLLSDHSSLHMLLQHVLQGRTAEAQVWRTHALASALPYLRQEPEIEVVMLDIALCGW
SRLATLVSTLRPCLGHRRLVLLVDALRDTALVRAHGVTVDLCLSKASGVTEMVERLLQSS
RPPHIAPICLDLHFGPTVIHAPKASAEFTQLVW
Download sequence
Identical sequences B1Y1H3
395495.Lcho_2005 WP_012347032.1.27902 gi|171058688|ref|YP_001791037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]