SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171058694|ref|YP_001791043.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058694|ref|YP_001791043.1|
Domain Number 1 Region: 30-171
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.53e-37
Family Glutathione peroxidase-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058694|ref|YP_001791043.1|
Sequence length 174
Comment redoxin domain-containing protein [Leptothrix cholodnii SP-6]
Sequence
MFVSCLESTLRLGRAALCAAGLATAVAAHAVDVGQPAPAVKLAGVQGTVDLAALRGQVVY
LDFWASWCGPCRVSFPWMNQMQARYGARGLQVVGVSVDAKREDADKFLAQLPANFLIAFD
PAGDTPKRYAIKGMPTAVLIGADGQVLHRHSGFRENDQQGLEAAIVAALKQAGR
Download sequence
Identical sequences B1Y1H9
WP_012347038.1.27902 395495.Lcho_2011 gi|171058694|ref|YP_001791043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]