SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058774|ref|YP_001791123.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058774|ref|YP_001791123.1|
Domain Number 1 Region: 8-168
Classification Level Classification E-value
Superfamily Nudix 1.62e-37
Family BT0354 N-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058774|ref|YP_001791123.1|
Sequence length 181
Comment NUDIX hydrolase [Leptothrix cholodnii SP-6]
Sequence
MLFTHRIKHCRACGTPVQYATPADDNRERAVCPACQTVHYENPLNVVGTVPTWEDRVLLC
RRNIEPRRGLWTLPAGFMEMGETTAEGALRETVEEAGAEIELQGLYTVLNVVPAGQLHLF
YRARLKHLRFDPGPETIEVGLFSQADLPWNELAFRTVRVTLERYFADRETGQFSIYHGDI
R
Download sequence
Identical sequences B1Y259
gi|171058774|ref|YP_001791123.1| 395495.Lcho_2091 WP_012347118.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]