SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058777|ref|YP_001791126.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058777|ref|YP_001791126.1|
Domain Number 1 Region: 183-292
Classification Level Classification E-value
Superfamily CalX-like 0.00000000419
Family CalX-beta domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|171058777|ref|YP_001791126.1|
Domain Number - Region: 944-1102
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0523
Family Putative isomerase YbhE 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058777|ref|YP_001791126.1|
Sequence length 1428
Comment outer membrane adhesin-like protein [Leptothrix cholodnii SP-6]
Sequence
MAAKSSSSELAASLAAKAAQIPSLRAVRLEADYVPARLPSGKVTGIWGEAFIRTPDGDLR
PLVVGDEIRKGDVIMTTQNGIVEIDDAGTRLARFPGTDALEQILTDLPPTGAGLSGGDPG
SLLPGVRVDRINESVDGQAFAFDAAERGEGQAFIAATDEVLIPTVVSVTPVAPDSTGDGV
PDVIEGTGAGNGNAVSYTVTLSSGASEPFTFSFGVTGTGTNQADPVSDLAPALTFTNGVV
LNADGSTITVPANVQSFSVTIVTNPDTIDEENETFNVSIGGVSGTVSIIDDDAIVVIDID
GPGAGNARQLNYTENDAASPIAPAMTLADPDSNIVSRATVSITGAFTVGEDVLAFTAVNG
IASNYVAETGVLTFTGTATLAQYQTLLQSVTYFNPSENPTATPRTVSFVVYDEIDRPSVP
ALATVNVIPVNDAPTNLPVVLAAIAEDSGVRVITQAELLANAADVDNTTLSVVGLTASSG
TLVDNGNGTWNYTPALNDDTAVSFTYSVSDGSLSVAGSAAMDITPVNDAPVNTPAVLAPI
AEDSVPRVITQAELLTNASDVDSPALTAENLVITAGGGTLVDNNDGTWTYTPAPDDDTTV
SFDYTVTDGSLSVPGSVTLDITPVNDAPVTTPVVLTAIAEDSVPRVITQAELLANASDID
SNTLTATGLTIAAGAGSLVDNGNGTWTYTPALNDDSSVSFNYTVSDGALSVPGTATLDIT
PVNDAPVNTPVTLAAIAEDSGARIITQAELLANATDVDGPALTAAGLTITAGNGILVNNN
DGTWTYTPAPNDDGAVSFSYTVSDGSLSVPGSAAMEITPVNDAPVTTPVVLAAIGEDSGA
RIITQAELLANATDVDSTTLTATGLTVAAGAGSLVDNGNGTWTYTPALNDDSAVSFNYSV
SDGALSVPATATLDITPVNDAPTNTPVTLASIAEDSGPRTITQVELLANAADIDGPALTA
SGLAIATGNGTLVNNNDGTWTYTPAPNDDTAVSFNYTVSDGSLSVGGSASMDITPVDDAP
VNTLPDPTTNLDGVTTNEDTPLFFSVANGNAITVFDADIVNDAGTLTTTISVAQGTFTLG
STNGVTVSGNGSSSVTVSGTPTAINAALNGASYRNVADFFTHNSNGGFIDSAGIGLTVTT
TDSTNLPDTDSTSLVVRAVTDVQIVTRVTNEGQATTPFTLASLVNVNDPGSGFEGAGPAI
TAINGTAVAAGGSVTVLNGVVTLTGDQSLVFTPNAGFTATAEDPASFTYTVASGGRTETA
AFFVQVDPIALPVQASPGVAASSAESIQSINAASTSPTQSSVDVFNGSVGSDVFAWHLGD
AGTAGSPRAYTVNDFDAAPASAGGDVLDLRDLLVGENADNLGAFLDFSKSGVDTVISISS
TGSGAADQTITLTNLDLAATIGLAPDASEAQMITALINQGKLLVDTAA
Download sequence
Identical sequences B1Y262
395495.Lcho_2094 gi|171058777|ref|YP_001791126.1| WP_012347121.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]