SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058932|ref|YP_001791281.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058932|ref|YP_001791281.1|
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000105
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171058932|ref|YP_001791281.1|
Sequence length 73
Comment hypothetical protein Lcho_2250 [Leptothrix cholodnii SP-6]
Sequence
MSEPVNPPWGLSPGQAAAVQAVIDTGCNKGAARLRDVSVKTIEVQAGDALRKSGKSNRLQ
MLIAFDRHMRGAA
Download sequence
Identical sequences B1Y3I8
gi|171058932|ref|YP_001791281.1| 395495.Lcho_2250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]