SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171058978|ref|YP_001791327.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058978|ref|YP_001791327.1|
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily CheY-like 7.12e-39
Family CheY-related 0.0011
Further Details:      
 
Domain Number 2 Region: 255-379
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000000103
Family Histidine kinase 0.021
Further Details:      
 
Domain Number 3 Region: 123-204
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000785
Family Homodimeric domain of signal transducing histidine kinase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058978|ref|YP_001791327.1|
Sequence length 394
Comment response regulator receiver sensor signal transduction histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MNKTVLVIDDSSVLRDIMREVLEDAGFNVIEAPHGQLGLERAQQLAPDIVLCDINMPVLD
GYGFVQAARAHEHLRTVPILMVTAMAEKKSMRRAMEAGADDFLSKPFTPEELVSAVTGQL
ARRERHEADTERSLDRLRGALLTSVPHELRTPLTNILGYSQLLIARGGRISADQQADMHR
HIHDSAQRLSRTIGRYMAWSELNAARGGGQLRSGERVDAHGLTDVLASKAFRTLVLDSLP
GEWASLPSNDRMLAGRLLRFDLAPAQIHCHCDDLLRVLAELISNGIKFSVPGATVSLEGR
MQPGGDYHVDVRNHGPALPAQVQKVSGALIQFGREQHEQQGSGLGLALCGLLAQRNGAGV
QWVRTDGAPNVVRLKLAARAVAEPQAGSEASAAA
Download sequence
Identical sequences B1Y440
395495.Lcho_2296 WP_012347320.1.27902 gi|171058978|ref|YP_001791327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]