SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059130|ref|YP_001791479.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059130|ref|YP_001791479.1|
Domain Number 1 Region: 172-346
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 1.64e-47
Family PurM C-terminal domain-like 0.00000655
Further Details:      
 
Domain Number 2 Region: 20-167
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 2.44e-35
Family PurM N-terminal domain-like 0.0000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171059130|ref|YP_001791479.1|
Sequence length 351
Comment hydrogenase expression/formation protein HypE [Leptothrix cholodnii SP-6]
Sequence
MSIKKDYIRPVDFKHGRVDMNHGAGGRASAQLIAELFARAFDNDYLRQGNDGALLDIPAG
HRLVMATDAHVISPLFFPGGDIGCLSVHGTVNDVAMLGATPLYLSASFILEEGFALADLK
RIVESMAAASRDAGVPIVTGDTKVVEQGKGDGVFISTTGIGVVPMDRQIGGALARPGDVV
LVSGTIGDHGVAVLSQRESLEFETTIESDTAALHGLVARLLAAVPEGAVHCLRDPTRGGL
ATTLNEITRQSGVGMLLQETAIPVAPQVNAACELLGLDPLYIANEGKCIVICAAEHADAV
LDAMRAHPLGRNAARIGSVTNDPHHFVQMATGFGGRRIVDWLSGEPLPRIC
Download sequence
Identical sequences B1Y5K2
gi|171059130|ref|YP_001791479.1| WP_012347470.1.27902 395495.Lcho_2449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]