SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059132|ref|YP_001791481.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059132|ref|YP_001791481.1|
Domain Number 1 Region: 302-471
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.94e-41
Family Histidine kinase 0.00063
Further Details:      
 
Domain Number 2 Region: 501-620
Classification Level Classification E-value
Superfamily CheY-like 1.34e-34
Family CheY-related 0.0018
Further Details:      
 
Domain Number 3 Region: 233-314
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.82e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0014
Further Details:      
 
Domain Number 4 Region: 598-611,649-732
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 7.85e-19
Family Sensor-like histidine kinase YojN, C-terminal domain 0.041
Further Details:      
 
Domain Number 5 Region: 83-207
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000288
Family Heme-binding PAS domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171059132|ref|YP_001791481.1|
Sequence length 846
Comment multi-sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MDRPEPSRDSAANPARRIGLIYAAFASAWILLSDKAVEWLFSSPHSITLAATLKGWVFVA
VTSVVLYVLVRRQTERERQTRAERRKAEEALRAERELLAGMSAIGHIGGWSFDPLTHEGS
WTEEVARIFDLDPSHPFDMATGLSCFEGESRQRIDAAIAAACTLGTRYDIELVLKSPKGR
IKSVSTVGIPEMQNGRVVRVRGYLQDLSEQKRLTQELADYRDHLEDLVRKRTVQLDEARA
RAEAANRAKSSFLANMSHEIRTPLNAILGLARLLRRSTLDAQQADRIAKIDDAAHHLLGL
ISDVLDLSKVEAGRQALDADDFELGALMAQVGNAVAHQAAAKGLALQIQAPPAPLWLRGD
AGRLRQALLNYMANAVKFTPTGWVRFDVQCEAAGERAVRLHFDVRDSGIGIAPEHLPRLF
NDFEQGDKSTTRRFGGTGLGLAVTRSLVELMGGSVGVDSAPGQGSRFWLHVTLPRGVAPS
PAPSPTLHPAPEEAVRARHAGARVLLAEDNLVNREVAVEQLQAAGLEVLTAEDGLAAVAR
VVADAPALVLMDIEMPLMDGLVATRAIRALPGGATLPILAMTANVTHEVRRACAEAGMND
FIGKPFEAENLYAALLRWLPARLDGVPPGPAPAPDPSATEPHAALPELIGIDWGLALARA
GGRASTSLRILRLFRRSHADDPERISTLIAAAAWPALRRLAHALRGAAGNIGAVQVQQAA
ASLEQILRDGSSSIEREVAARALQSQLHALFVGLDALGEAPVSAPSAPVPALAPQAALEQ
LDILLAAGDMACYRLLTEQSAVLQAALGEAFRPLVALVDTFRYEEAAALLREARHKSAPD
PGHPHG
Download sequence
Identical sequences B1Y5K4
395495.Lcho_2451 gi|171059132|ref|YP_001791481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]