SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059157|ref|YP_001791506.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059157|ref|YP_001791506.1|
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily CheY-like 5.55e-40
Family CheY-related 0.00012
Further Details:      
 
Domain Number 2 Region: 137-229
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.02e-25
Family PhoB-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059157|ref|YP_001791506.1|
Sequence length 241
Comment two component transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MNAPRPDHVLVVEDEPRLARLVSDYLVAAGYTTRIVDHGLDVLPAVRQHAPDLIVLDLML
PGRDGLSLCQELRRFSEVPVIMLTARVEEVDRLIGLEAGADDYICKPFSPREVVARVKAV
LRRHKRVPTDLVAAPSSPLVIDEERHRALLDGHELDLTPVEFRLLKALAAAPGRVFSRDQ
LLDKLHDDTRALSDRTIDSHVKNLRRKLEQACPGLEPIRSIYGVGYRFELGDDTRAWSSS
P
Download sequence
Identical sequences B1Y5M9
gi|171059157|ref|YP_001791506.1| WP_012347497.1.27902 395495.Lcho_2476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]