SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059183|ref|YP_001791532.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059183|ref|YP_001791532.1|
Domain Number 1 Region: 341-509
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-41
Family Histidine kinase 0.00091
Further Details:      
 
Domain Number 2 Region: 678-797
Classification Level Classification E-value
Superfamily CheY-like 3.84e-37
Family CheY-related 0.0025
Further Details:      
 
Domain Number 3 Region: 528-654
Classification Level Classification E-value
Superfamily CheY-like 1.14e-25
Family Receiver domain of the ethylene receptor 0.049
Further Details:      
 
Domain Number 4 Region: 270-353
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.69e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 5 Region: 135-258
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.03e-19
Family BphP N-terminal domain-like 0.082
Further Details:      
 
Domain Number 6 Region: 775-788,827-925
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 7.98e-17
Family Chemotaxis protein CheA P1 domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059183|ref|YP_001791532.1|
Sequence length 957
Comment multi-sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MTIDKRRFAAPLTPLVALAIQWSFWPWLQPFAWFLFYPAIFFAARLGGRIGAWLATALSV
VLVWTVFIGPSPGVGNPSAVFSTIVFALMGILFGEAQEQLMRALRKDRQALDGSQAELQR
HRDHLQELVDARTAELEKAMQARGDAEAFVRAIADNLPARVSFWDVDLRCRFVNQRFCHD
EGRPREALIGASLIDVFGAGRIGEVEARLRMAMQGQAQHFERIVPGLDGTTRTLWVHHIP
VIRDGRLRGVVAMGTDISEIKRDEIRLRQLNTELAQARDHAEAANRAKSTFLANMSHEIR
TPMNAIIGLTQLLRRTHRDPAGAEQLAKVADAADHLLQIINDVLDLSKIESGKVELESID
IDLDELLSRTLSLVSSRAHEKGLELVLDTDHLPRTLRGDPTRLSQALLNLLTNAIKFTDH
GSVILRGQKLQDGADGVHVRFSVQDTGIGVEADQVEALFLAFEQGDSSTTRRHGGTGLGL
AITRHLAQLMGGESGADSVAGQGSTFWFTARLAHARTLQPPRRPTALHGLRVLLADDLEP
AREAMAEMMRSIGLRVDAVASGEQALAALQDVSPDPYRLVLLDWCMPGLDGIETARRMAQ
LALPQRPPVVLVSAQDDDTLPALARTVGIGTVLLKPLTASSLHDAVIGLLQIDAPRAAAT
PPQALQQLERQLRQRHGGAPVLLAEDNPINQEVASSLLQLAGLQVDVADDGAQALAMAET
TDYRAILMDMQMPVMDGLQATRAIRALPRAAGLPIIAMTANAFGEDRAACLAAGMNDHIA
KPVNAQVLYATLLRWLDAHPPPLETPMTPEKPADRDATPGSGFAAIEGLNIQTGLRQMGG
RMSTYVRIIRRFTELYGRGIAGLNQALLDGDGAAARNAVHAFKGASGTIGATSLAEQASA
LEHDILARRPTSELVEAVEHLQQDLARMVEALDQALPAESEAVAAHGAAARPAGGAA
Download sequence
Identical sequences B1Y6D1
gi|171059183|ref|YP_001791532.1| 395495.Lcho_2502 WP_012347523.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]