SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059210|ref|YP_001791559.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059210|ref|YP_001791559.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily CheY-like 5.41e-39
Family CheY-related 0.00013
Further Details:      
 
Domain Number 2 Region: 130-225
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 6.8e-23
Family PhoB-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059210|ref|YP_001791559.1|
Sequence length 232
Comment two component transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MPRLLLIDDDEHLAAPLAAYLRRFDLDLDHAERPSLGLQRLAGGGYDAVILDVMLPEMDG
FEVCREIRKTSQIPILMLTARGDVMDRVIGLELGADDYLPKPFEPRELAARLQTILRRQR
APAPAAAAVSTTPLVFDGLVIDLERRQVLVQGRPVELTGTEFELLVLLAREPQKVFSRDD
ILIRLRGQESDDLFTRAVDILVSRLRKKLEPLDCIKTLRNAGYAFAGARLVP
Download sequence
Identical sequences B1Y6F8
WP_012347550.1.27902 gi|171059210|ref|YP_001791559.1| 395495.Lcho_2529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]