SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059265|ref|YP_001791614.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059265|ref|YP_001791614.1|
Domain Number 1 Region: 1-202
Classification Level Classification E-value
Superfamily YrdC/RibB 3.36e-61
Family YrdC-like 0.000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059265|ref|YP_001791614.1|
Sequence length 208
Comment Sua5/YciO/YrdC/YwlC family protein [Leptothrix cholodnii SP-6]
Sequence
MAQFFEVHPDNPQPRLLKQAVAIIAAGGVAAIPTDSSYALVCQLDDKAAADALRRIRGVD
DKHHLTLLCRDLSELSSYARVDNRQYRLLKSATPGPYTFILEATKEVPRRLSHPSRRTIG
LRVPDHRVTQDLLDLFGQPLLGTTLIPPGEIHPLNDCAEIRERFERLVQVIVDAGPCPAE
PTTVVDLSSGDPVLVRAGRGDLATVGLD
Download sequence
Identical sequences B1Y794
395495.Lcho_2584 WP_012347605.1.27902 gi|171059265|ref|YP_001791614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]