SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059270|ref|YP_001791619.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059270|ref|YP_001791619.1|
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily CheY-like 4.98e-38
Family CheY-related 0.00036
Further Details:      
 
Domain Number 2 Region: 155-348
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.42e-33
Family HD domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171059270|ref|YP_001791619.1|
Sequence length 375
Comment response regulator receiver modulated metal dependent phosphohydrolase [Leptothrix cholodnii SP-6]
Sequence
MPDSIILIVDDNPENLTVLGELLRSHYQVRAANSGPSALRLAALVPRPQLVLLDVMMPGM
DGYEVLRLLRADESTRDIPVIFTTSLDATEDEELGFTLGAVDYITKPLRPAIVLARVRTH
LELKQARDRLQEQNTDLEAEVVRRMGENLLIQDVSILALAHLAEIRDPETGNHLLRTQEY
VRCLGHALSSHPRFADVLDSHTVELLAKSAPLHDIGKVGIPDHILLKPGKLSPEEWVVMQ
THARMGAEAIEHAERDAARPVEFLAFAKQIAHHHHERWDGNGYPDGLAGDAIPLAARLMA
LADVFDALISRRVYKEPFPPEQARDMMARERGRHFDPDMLDAFLRVFDDFCAIAERYVDS
QDSVDAKHRQLTASR
Download sequence
Identical sequences B1Y799
gi|171059270|ref|YP_001791619.1| 395495.Lcho_2589 WP_012347610.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]