SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059272|ref|YP_001791621.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059272|ref|YP_001791621.1|
Domain Number 1 Region: 448-558,800-853
Classification Level Classification E-value
Superfamily Cupredoxins 6.34e-25
Family Multidomain cupredoxins 0.004
Further Details:      
 
Domain Number 2 Region: 239-346,398-424
Classification Level Classification E-value
Superfamily Cupredoxins 0.000000000332
Family Multidomain cupredoxins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059272|ref|YP_001791621.1|
Sequence length 895
Comment multicopper oxidase type 2 [Leptothrix cholodnii SP-6]
Sequence
MAVAQSTGSLDFFGDPPATDPSAYVEPKIGADGEAYLLAQANPANHGAFDGGLTGTHVDP
QAQTSVPQAEMTSANVPTNSKPSPLMGARMFDTPMLMFEEFGTDRLDPSVAAPTQPFPRP
KIGAAPESDPVSVARSAPDGVELDSFLAQRGIAPYPTRESNTLDQNPWAAEVADFLDRQL
TGAPAEGRPPGEGWAHQRWNEFSPQVFYKTAQTGARLNRGLRDSRQLHGFRVGEWAPGGL
YHRFGTNSGTKVQFHPGLPVQNHNAVWTFDGTMPPKLLMARYGQPLLMRHYNALPIDPAA
NKGFGLHTITTHEHNGHNPAESDGFANAFFFPGQFYDYRWPMQLAGYDTINTTATDDRAA
FPCSTGETLYVNDLSPGLKTCQNGRIRVRGDWRETMSTHWFHDHMLDFTAQNVYKGNAAM
MNYYSALDRGNEVLNDGINLRLPSGSALPWGNRDYDVNLLLADKAWDKEGQLWFNVFNKD
GFIGDRILTNWTYYPYLDVRARRYRFRILNGSVSRYFMVALVQQVSGTAGEFQGPAGSNV
SYNRVPFHMVANDGNLLEHAVAFDGKVDLDRNGNKAEHKGMLPIQGIAERYDIVVDFASF
AAGSKLYFVNVLEHTKGEVTGSKISLARILSESYKPLARDKDGDRVADRWENGDPGVGRF
MELRVHPSSGTDKSMNPANFVAGKKKMIPLTLDRDSAADYAKLSQARHRTFEFGRSGGTD
AQPWTIRTDHDLAVGADPRRTSAAPQLTQGPTPAGFAGNGTLEVWKLDLGGGWSHPIHIH
FEEGIVLRRGGKAPPDWEKWARKDVFRLGPDSESGDSVEVALRFREFAGTFVEHCHNTQH
EDSSMLLRWDVERPGQVLAMPTPMPTWEGVDYVGQAALPTFRTGDGTGPSYAFGR
Download sequence
Identical sequences B1Y7A1
395495.Lcho_2591 WP_012347612.1.27902 gi|171059272|ref|YP_001791621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]