SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059359|ref|YP_001791708.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059359|ref|YP_001791708.1|
Domain Number 1 Region: 642-802
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.71e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 2-190
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.13e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0017
Further Details:      
 
Domain Number 3 Region: 142-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0037
Further Details:      
 
Domain Number 4 Region: 531-650
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.96e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171059359|ref|YP_001791708.1|
Sequence length 821
Comment nitrite reductase (NAD(P)H) large subunit [Leptothrix cholodnii SP-6]
Sequence
MKKMKLVMVGNGMAGVRTLEELLKIAPDLYDITVFSAEPHPNYNRILLSPVLSGEQTLDE
IILNPVSWYEENGITLHLGKRVAKVDRTRRIVYAEDGTEAEYDRLLMATGSNPFMLPVPG
ANLEGVIAYRDIADTNTMIETARTHKHAVVIGGGLLGLEAANGLMLRGMQVTVVHVMPWL
MERQLDDVAGGLLRKSLEDRGLKFALGAQTQALIGDQADGKAGRVKAIQFKDGTELPADL
VVMAVGIRPNTALAKSMGLLCAQDGRGGIVVDDTLQTTTDARIYSVGECAAHRGIAYGLV
APLFEQGKVCATHLAQFGIGRYTGSQTSTKLKVTGIDLFSAGNFTGGEGFEEIVLSDPVG
GVYKKLVIKDDKLVGACLYGDTVDGSWYFKLLREGRKVHDIRDKLMFGESNIGDAGHQGH
NKASAMADADEVCGCNGVTKGAICKAIKEKGLFTLDEVRKHTKASASCGSCTGLVEQLIM
FTAGGDYSATPKKKAVCACTDASHQEVRDTIRNEKILTIDGVYQRLGWKTPNGCASCRPA
LNYYLISTWPKEAQDDPQSRFINERSHANIQKDGTYSVVPRMWGGETTAADLRRIADVAD
KYAIPTVKVTGGQRIDLLGVKKEDLQGVWQDLGMPSGFAYGKSLRTVKTCVGSDWCRFGT
QNSTQLGKDLERALWAMYSPHKVKLAVSGCPRNCAEAGIKDVGIIGVDSGWEMYVGGNGG
IKTEVAEFFVKVKTTAEVLEYAGAFLQLYREEGWYLERTVHYINRVGLDYVKDKILNNAE
LRRQLWERLQFALDGAADPWLASAQASVDVRQFEPVANASA
Download sequence
Identical sequences B1Y873
395495.Lcho_2678 WP_012347699.1.27902 gi|171059359|ref|YP_001791708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]