SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059398|ref|YP_001791747.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059398|ref|YP_001791747.1|
Domain Number 1 Region: 464-712
Classification Level Classification E-value
Superfamily EAL domain-like 9.29e-87
Family EAL domain 0.002
Further Details:      
 
Domain Number 2 Region: 274-451
Classification Level Classification E-value
Superfamily Nucleotide cyclase 9.42e-48
Family GGDEF domain 0.000091
Further Details:      
 
Domain Number 3 Region: 9-143
Classification Level Classification E-value
Superfamily CheY-like 2.28e-34
Family CheY-related 0.0016
Further Details:      
 
Domain Number 4 Region: 133-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000541
Family BphP N-terminal domain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171059398|ref|YP_001791747.1|
Sequence length 720
Comment response regulator receiver modulated diguanylate cyclase/phosphodiesterase [Leptothrix cholodnii SP-6]
Sequence
MYLRDEEPDRQPRILLVDDDEVTLLLTSAALRERGFAVTEATGGLSALRLLGDWTPDLIV
LDAMMPGLDGFDTCVELRGLPGFELMPVLMLTGLDDEASIERAYEVGATDFFVKSHQWRL
LAGRLRHLLRTARIQLELLRSRSKLARAQDLARMGSFEWRGDSAGLMLEPEALRVLGHGP
HDHLGLRRLLRSLVANERAGVCSRLREVVRHSTVLDTDVNVVMPDHRQRIIHIEAEPEFN
EHGNVVGYAGILQDVTDRRLIEDKIRHLANFDALTGLPNRRQLIWRAERALEHARRLGHP
CALLLIDLDRFKVINDTLGHGVGDELLMEIGRRLRSCVRHSDQLADMSIDATLLRSHRSL
EAVARLGGDEFVTLLPEVADEPEALETAQRILEAMRAPVVLGGAEYFVTASVGLAMFPRD
GISVVDLLRNADMAMYAVKDSGRNNVKVFQPQMSGKGREKLELESALHKALERGELVLHY
QPKVDVARGRLVGVEALMRWHRNGELVPPGDFIPLAEETGLILPISEWAMREATRQIRSW
RDSAGLDLKVAVNLPSRSFERGNVLDHIHEAAAAHDVPLSSLELEITETSLMKGLDEVMP
MLHRLTQHGVGISIDDFGTGYSSLSYLTQLPISELKIDRSFVQRLDRTGGSSAVVTAIIA
LAHSLKLKLVAEGVENEYQRDVLLRLGCHTMQGFLFSQPLPPDEVVRWVTEFRRKAVARV
Download sequence
Identical sequences B1Y8B2
gi|171059398|ref|YP_001791747.1| 395495.Lcho_2717 WP_012347736.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]