SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059399|ref|YP_001791748.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059399|ref|YP_001791748.1|
Domain Number 1 Region: 650-822
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.38e-47
Family Histidine kinase 0.0025
Further Details:      
 
Domain Number 2 Region: 980-1103
Classification Level Classification E-value
Superfamily CheY-like 1.35e-34
Family CheY-related 0.0038
Further Details:      
 
Domain Number 3 Region: 842-965
Classification Level Classification E-value
Superfamily CheY-like 2.99e-30
Family CheY-related 0.0028
Further Details:      
 
Domain Number 4 Region: 582-662
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.96e-21
Family Homodimeric domain of signal transducing histidine kinase 0.002
Further Details:      
 
Domain Number 5 Region: 1134-1250
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.09e-19
Family SphA-like 0.065
Further Details:      
 
Domain Number 6 Region: 446-574
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000192
Family Heme-binding PAS domain 0.092
Further Details:      
 
Domain Number 7 Region: 217-325
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000506
Family Flavin-binding PAS domain 0.053
Further Details:      
 
Domain Number 8 Region: 320-440
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000768
Family BphP N-terminal domain-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059399|ref|YP_001791748.1|
Sequence length 1255
Comment multi-sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MPANVKPVETLTPDLLWRLARAVSSTSRLLDAMTVVAPSVARALGAQGVGLVQVMQWRPA
SSLVQPWGPESSTDDEWIDLAQLVLVEAERCPLGRALSRGQVEYGAVGVSPQAWNWRAPG
VRQVLVLPVLTLETPDHGPGPVAVAGLAASEPLRPTLAALEFHDPDRFDPEVLPLLGMLA
LQLAAVARREADLQLARQRDEQLAQVAMLASRTGRSTVITDQNGRIEWVHPAFAEITGHL
PLEVQGRPLWEALARDLTRSDAAAQLRTLFAGSGAFRHEFVARRGQACAEPGQPYWLEVD
AAQVIDETTGRLQFVCLCSDISSRKAHESGNDEQRELLAALTENLPISLLVLDAQRMQVL
SLNRHAQIEFGVSPTPGNSGLDDMLGAGLHERIRAELDEVLQRPGAVEHEFVWPTVEGRR
VISARHVAVQDRHGPPRVVITQLRDVTRQRRDELRLRESETRYRELVETIDEGVFISNPA
RDQWYYIGPRMYQMLGLKVADRREHPDLLQSLVLPDDARLLAQQREHEEALEATDVTLRI
RHPGRGLRWLRQRTRTRVLPGGETRVYGLLDDVTDERERALQLQAARDVAEAASQAKSQF
MASMSHEIRTPMNGILGMTELLLGTRLDDRQRRFAQAVYRSGENLLEIINDVLDFSKIEA
GRLELAPTDFNLRTLIEDTLDLLAPRAHEKGLELSFRETGDVPANVLADPLRLRQVLTNL
VANAVKFTEHGEVTVDLRFLPRPRAGAPAMLEFRVRDTGIGMAAELLPRLFTAFTQAHGG
MARRYGGTGLGLAISRQLVELMGGQIDVVSQPGVGSEFRFTMTFEPGSGRDSEAGELTAL
PQARVLVVEDHATNRTVLDHLLSAWGLSVTLAVDGQAALELLRNRPADQPDFDIALVDWR
MPRLDGIGFAKALRAEGLAPGTQLVMLSSASAPDDARLAQDAGFVRFIHKPVRKAELRQA
ILGVTASRGVEPVDAQVRAQVLVVEDNPVNQEVMGQMLHRLGCRVRVAGTALDGLRVLCE
QPVDLVLMDIQMPGMDGIEALHWIRRGESSRFKLRTPANLPVVAVTANALDGDEERFLGF
GFDAYLSKPYRQSQLLGILQGVVPGLVGTGLPADDSRAAPDPAPAPPGEATLRGGAPMLD
VQALQRLRELDPGGRNRLLERVLKAFDASIGRMLTQLAEGQSGQDAALVRHVLHTLKSSS
QSVGALALAQMCVDCEAQLRQGVGLDLLATRLNQLQLEMLRVQQGLHPYIEAQPA
Download sequence
Identical sequences B1XWI2
395495.Lcho_2718 gi|171059399|ref|YP_001791748.1| WP_012347737.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]