SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059427|ref|YP_001791776.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059427|ref|YP_001791776.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily CheY-like 5.55e-37
Family CheY-related 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171059427|ref|YP_001791776.1|
Sequence length 120
Comment response regulator receiver protein [Leptothrix cholodnii SP-6]
Sequence
MKKILIVEDQQDIRELIRMTLEIEDYEVHEAPQGDIALQMIGRINPDVMLLDVMMPGGID
GFEVCRRVKADARFKRTKVVMLSARGSSADRDTGKRAGAADYLVKPFSPRQLLQVIDRVS
Download sequence
Identical sequences B1XWL0
WP_012347765.1.27902 gi|171059427|ref|YP_001791776.1| 395495.Lcho_2746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]