SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059465|ref|YP_001791814.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059465|ref|YP_001791814.1|
Domain Number 1 Region: 120-270
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.1e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 410-555
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.16e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0013
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.91e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.025
Further Details:      
 
Domain Number 4 Region: 316-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.58e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059465|ref|YP_001791814.1|
Sequence length 568
Comment sulfite reductase [Leptothrix cholodnii SP-6]
Sequence
MYQYTPFDRQFVHARAAQFRDQLERNLAGTLGDDEFRALRLQNGWYIQRHAPMLRVAVPY
GELNSAQLRAMADIARKHDRGYTHFTTRQNVQYNWIPLPQAADVMDKLAAVDMHGIQTSG
NCIRNITSDALAGVAADEAIDPRPYCEIMRQWSTLHPEFAHLPRKFKIAVSGATEDRAAT
GWHDIGLVLRKNEAGEIGFQVRVGGGMGRTPIIGSVISEFVPWQQILVFIEAVVRVYNRY
GRRDNAYKARIKILVKAEGQKFFDAVAVEFKNILERDLDGSAHLITQAEFDRVNACFVRP
AGVVAQPEVAAAADLPLAYRRWLERNVHAHQVAGYRAVTLSVKRAGQAPGDVTDAQMDQA
ADLADVYSCGELRVTHDQNLLLPWVKAADLPALYEAAKAAGYATPNIGLLTDMIACPGGD
FCALANARSIPVAAEITERFDDLDEVFDLGDIDLHISGCINSCGHHHSGHIGVLGVDKDG
TEWYQLTLAGSDGSNHAPTAVTGKVIGPSFAASEVVDAIEAILDVYRAERTAGEKFIDAV
KRLGLEPFKAAANARRTATARHSDTAEA
Download sequence
Identical sequences B1XWP8
395495.Lcho_2784 gi|171059465|ref|YP_001791814.1| WP_012347803.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]