SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059584|ref|YP_001791933.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059584|ref|YP_001791933.1|
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000275
Family PHP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059584|ref|YP_001791933.1|
Sequence length 1109
Comment DNA polymerase III subunit alpha [Leptothrix cholodnii SP-6]
Sequence
MQAGLPDYAELHCRSNFSFLSGASHAEELISRAARLGYRALAITDECSVAGVVRAHEAAR
HPRGERAPDDPGLLRLIIGSEFTLSPAAASGTRPPHPGGRLLLLVRNRAGYGQLCTLITL
ARSRCAKGDYRLDADDFDPAPSDCWALLLPRREDDLPTLLTQARWLVARFGERARIAIEL
LQHADDNLRIAHARAASQASGAPLVAAGDVLMHVRSRKPLADTLTAIRHHLPLADCGHLL
MRNAEQHLRSRLALAQIYRPEWLAESVRIADACTFSLDELRYEYPDEIVPAGHSASSYLR
QETLAGAARRYPPHSHPDGIPPGVLAQIEHELALVAEMRYEAFFLTVHDIVRQARRLGIL
CQGRGSAANSAVCYCLGITEVDPTQTTLLFERFISRERGEPPDIDVDFEHERREEIIQYI
YAKYGRHRTALAAAVSTYRVRGALRDVGRAFGLDELLIDAVAKSYQWFDGRGALSERLAE
QGLDAESPVTQQWLELATTLMGFPRHLSQHSGGFVIARESLSQLVPIEPAAMDGRQIIQW
DKDDLESLGLLKVDVLALGMLTVLRKSLDLANAWHGRTAQAWRGGSGSFSHRAPQRPERE
PWTLHHIPRDDPATYAMIRKADTVGMFQIESRAQQSMLPRLRPDKFYDLVIEVAIVRPGP
IQGGMVHPYLRRKQGKERADSPYPALDAALARTLGVPIFQEQVMQVCMIAAGFSPGEADG
LRRAMAAWRRKGGVHHFHERIVGGMVERGYERAFAEGIFRQIQGFGEYGFPESHAYSFAI
LAWFSAWLKCHEPAAFLAALLNSQPMGFYGPAQLVADARRHQVEVRPVDVTRSDWDCTLE
APSPAAAAPATDPPASARPPGSGAGGPAVRLGLRQVGGLSQASAERLLQARREAAFIDVH
DLARRAALDPHELQTLARADALAALAGHRRQQVWAAAAPPAAPLTTGTGPGAGLLQDAPI
REPQLSLIEAPEGEAVTLDYAATGLSLRRHPLALLRERLRRQAVKSAAELARVPDGRVVR
ACGLVVSRQQPGTAHGTVFVTLEDETGVVNLIVWQDVRERYRRALLESRLLAVRGTWQQR
DGVAHLLAHDLFDISGWLGPLQTRSRDFH
Download sequence
Identical sequences B1XYC3
WP_012347922.1.27902 395495.Lcho_2903 gi|171059584|ref|YP_001791933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]