SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059804|ref|YP_001792153.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059804|ref|YP_001792153.1|
Domain Number 1 Region: 152-252
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000000555
Family CheY-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171059804|ref|YP_001792153.1|
Sequence length 270
Comment response regulator receiver protein [Leptothrix cholodnii SP-6]
Sequence
MDVQKDVISHREFLVSTEKFAESAKGFTKSPLGIIALFIVLVYGFASIVVGLGRGISDHI
APLIYFMVFFPILVFLGFLWLVAKHYNKLYGPSDFKNEDNFLKAQMATTASLVAATVRQP
GHEGGLQESQLREIVNVVSNTPKNPVKEKWKNRVLWVDDRPGNNVYERQAFEAQGVEFTL
ALSTQEALELLRNNKYAAIISDMGRKEGLDEGYVLLEKLRSSGNKTPFVIYAGSNLPEHK
KEARERGANGSTNRADELFQLIMSLIANGL
Download sequence
Identical sequences B1Y0X1
gi|171059804|ref|YP_001792153.1| 395495.Lcho_3128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]