SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171059951|ref|YP_001792300.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059951|ref|YP_001792300.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily L21p-like 1.96e-37
Family Ribosomal protein L21p 0.0000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171059951|ref|YP_001792300.1|
Sequence length 103
Comment 50S ribosomal protein L21 [Leptothrix cholodnii SP-6]
Sequence
MYAVIKTGGKQYKVAAGEKIKVEQIAAEVGQEIVIDQVLALGSGADLKIGTPLVEGATVT
ATVLAQGRHDKVRIFKMRRRKHYQKRQGHRQNFTELQISAVLG
Download sequence
Identical sequences B1Y282
WP_012348282.1.27902 gi|171059951|ref|YP_001792300.1| 395495.Lcho_3277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]