SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060071|ref|YP_001792420.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060071|ref|YP_001792420.1|
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.1e-22
Family Transposase IS200-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171060071|ref|YP_001792420.1|
Sequence length 237
Comment hypothetical protein Lcho_3397 [Leptothrix cholodnii SP-6]
Sequence
MARLPRLALAGMPHHVLQRGHHHQPVFVDDDDRRAYLQALQEAAANLRVAVHAYVLLDDQ
VQLLLTPPSAQALSRLMQAVGRRYVSAYNRRHQRAGTLWDGRFRAAVLDEQSHLLACARA
IEQSPQVAGRVGRAIDWPWSSAAHHVGSRRDPLLTVHRRYWALGNTPFERELAWQRLLDE
PLPAASRQQIVHAVNQGWAIGSGAFLASMAHSTARPLAPRPRGRPPGAPKRDKLPAA
Download sequence
Identical sequences B1Y2Z9
WP_012348402.1.27902 gi|171060071|ref|YP_001792420.1| 395495.Lcho_3397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]