SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060137|ref|YP_001792486.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060137|ref|YP_001792486.1|
Domain Number 1 Region: 640-810
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.49e-42
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 984-1107
Classification Level Classification E-value
Superfamily CheY-like 3.98e-37
Family CheY-related 0.0015
Further Details:      
 
Domain Number 3 Region: 310-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-22
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 4 Region: 572-652
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 8.04e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0022
Further Details:      
 
Domain Number 5 Region: 827-963
Classification Level Classification E-value
Superfamily CheY-like 1.71e-18
Family CheY-related 0.0048
Further Details:      
 
Domain Number 6 Region: 432-557
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-17
Family Flavin-binding PAS domain 0.053
Further Details:      
 
Domain Number 7 Region: 1081-1094,1128-1216
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.49e-16
Family Chemotaxis protein CheA P1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060137|ref|YP_001792486.1|
Sequence length 1333
Comment multi-sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MFSSQSDEPPLPPQIDDTTAWPAPRPRAGWQGLLLLGALSFGLATLALLLLRQPESIASV
WWANAVAAGFLVRHARAAWPGLLLVSALAITLANIVLGNPVITALAFMLANLVETGLMAL
MIVQVRSRQRPFGGPSTLLAMLLAAAVLPAAASASVATVLLGALGEPVPAAIWTVWFQGA
VLGAVATLTMVLEWPLGPQAQPLRRRDLALVAGAALACALISALAIRSMPHPFVYVSAAL
VVAAVQLPLWGAGLVVFTSSLAMSVVVGLGTVPAGQDPPLFASGWVTVLPLLLTMLPPLL
LAAAQARGRRDRHRLANSEATFRLAMERSALGMALVTIDGRILRSNPALQQMLGYGADEL
AQMRTRELRHPEDPELAGSGLQQLASSEGGRYSAERCYAHRDGSKVWVQLSAALVRDERG
QVLYTLMQVDDVTERRDRLAALQASERFLRFIADNVPGMLAYWDRDERCVFANRAHIEWL
GHDPTRPPQPRLADVIGAERYALSKPHIRAVLAGEPQQFERGHTARDGSLVDAWLQYVPD
IEDGVVRGFFVQVSDITELKAAQRKLADANAELAARTRQAESANAAKSEFLANMSHEIRT
PMAAIVGLSHLLENSRLNPDQQDLLRKMRGASKSLMAVIDDVLDLSKIEAGELRIDRSAF
SLQALLDDLRGLMALSAHDRTLELVMRCDAGLPDQLDGDLMRLRQVLNNLLSNALKFTTV
GEVLLQVALVARQSGRLRLRFTVRDSGIGISAAEQARLFRPFAQVDASTTRRYGGTGLGL
VISRRLVRLMGGDISLRSAPGKGSEFSFDLSFDVDEASVPAGAGGAPIHVLVVDDHALQR
AVLSEAAASLGWRVEAVASSDAAIERTVAQAAAGAPFDALVLDWQMPGRDGLATLALLHR
RLAECAADGVFAEMPPLVMTVAPSEEDALRREPAAASIDAVLCKPIMASTLASAVAAARA
RQRSGTAWPADPAAQAAQRLPHVCVLVVEDNSINLEMARLILEREGALVNAAGNGREALD
LLQARPDAFDIVLMDLQMPVMDGFEAVRLMRERADLQAVPVIALTAGALPSDRERAHAVG
MSDFISKPFEVEHLVRTVRAHVQRVRREVLSSHVPAVLALPADWPAIDGIDAQSAHGRML
GDEALFKRLLARLFDEFGGIAGELRQAIDAGFVEQARQQAHKLRGVAGNLGAHPVHVVAG
ALETVLEQVPRHAGTPLNAELMSRIQAMLAELGAAMVRLQVASAPTLQTLLQPPPPRPER
VAPPPTAGELDALVQALRQNDLTALRLFKALSDALAGQIEGKSFANLRMCIEGLRFEQAL
AELQDAGLITRTR
Download sequence
Identical sequences B1Y3L8
gi|171060137|ref|YP_001792486.1| 395495.Lcho_3463 WP_012348468.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]