SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060138|ref|YP_001792487.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060138|ref|YP_001792487.1|
Domain Number 1 Region: 448-694
Classification Level Classification E-value
Superfamily EAL domain-like 6.67e-84
Family EAL domain 0.0018
Further Details:      
 
Domain Number 2 Region: 271-434
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.73e-42
Family GGDEF domain 0.00016
Further Details:      
 
Domain Number 3 Region: 5-137
Classification Level Classification E-value
Superfamily CheY-like 6.4e-37
Family CheY-related 0.001
Further Details:      
 
Domain Number 4 Region: 143-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171060138|ref|YP_001792487.1|
Sequence length 704
Comment response regulator receiver modulated PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Leptothrix cholodnii SP-6]
Sequence
MSSLPRVFIVDDDVAAIQLLSRILEPQYTVCFATSGADALTRLGHDRCDIVLLDAQMPGM
DGFELLRRIKRDPYLQGMPVVFVTAHVDEANESLALALGAADFITKPFSPPVVHARVANV
LRLYRDNAENLQRNEARWIFAVEGAEQGVWDWDLREHSVTLSQQWRILLGDDEGAGDTSV
DAWRARVHPDDAAAVQRRLDRHRRGISSGYESEHRMRCGDGSYVWVLEGGRVVQHDEAGR
PMRMIGTLSDISRRKEAEAQAFSLAFYDPVTELPNRRRLVELLRFSLVGDQLGQGSATLC
LVDLDHFKLVNDAHGHDVGDQLLRQVAVRLKACVRQQDIVARLGGDEFAVLLMHERRSAV
SPAAAAEAAGAKLLAVLAEPYAIGDHLHHCSASMGVVAVDADKAEQAEQLLKWADIALYE
AKRAGRGCLRFFDPAMQAAVEARSALEAELRTALACRQFQLVYQLQVGDRSAALGAEALV
RWHHPQRGVIGPTEFIALAEETGLIVPLGRVLLEQVCEQLCAWERDADLDDLTVALNISA
RELHEPDFVDFVLATLARTGAPVRRLKLELTESALVGDVDDIAARMHRLRDHGVGFSLDD
FGTGFSSLSYLKRLPFDQLKIDRSFVRDILEDTVDARLSRAIVALAASLGLSVVAEGVEL
AAQGDMLREFGCRQFQGFLYGVPMPAAEFSSVLRAARREAGAVV
Download sequence
Identical sequences B1Y3L9
gi|171060138|ref|YP_001792487.1| 395495.Lcho_3464 WP_012348469.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]