SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060162|ref|YP_001792511.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060162|ref|YP_001792511.1|
Domain Number 1 Region: 12-232
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.88e-70
Family Mismatch glycosylase 0.0000134
Further Details:      
 
Domain Number 2 Region: 228-380
Classification Level Classification E-value
Superfamily Nudix 4.26e-16
Family MutY C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060162|ref|YP_001792511.1|
Sequence length 384
Comment A/G-specific adenine glycosylase [Leptothrix cholodnii SP-6]
Sequence
MSRAATAELPSIAADLVRWQRQHGRHGLPWQASRDPYRVWLSEVMLQQTQVATVLGYYER
FLQRFPDIAALAAAPLDDVLALWSGLGYYSRARNLHRCAQVVVAEHGAALPRRAEQLVEL
PGIGPSTAAAIASFCHGERVSIFDGNVKRVLARLLAFEGDLAQAGAAKVLWAQADRLVPT
DAADMPAYTQGLMDLGATVCTPRDPQCPACPLQRACRAHAAGSVLTYPIKSRKLKRSRRE
NWCLWLSLGDAVWLQQRPDTGIWAGLWAWPLFDDTDAVERLTAQLLAALGGHAERLQANR
LPGFVHVLTHLDWTLHPCRLHLPAPVVLQAREPGGGDGERGDGPLERLDAVLNQQLGAGR
WHAAADLHRLGLPAPLRKVLLDIT
Download sequence
Identical sequences B1Y3P3
395495.Lcho_3492 WP_012348493.1.27902 gi|171060162|ref|YP_001792511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]