SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060166|ref|YP_001792515.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060166|ref|YP_001792515.1|
Domain Number 1 Region: 40-172
Classification Level Classification E-value
Superfamily Prokaryotic lipoproteins and lipoprotein localization factors 9.02e-16
Family Outer membrane lipoprotein receptor LolB 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060166|ref|YP_001792515.1|
Sequence length 198
Comment hypothetical protein Lcho_3496 [Leptothrix cholodnii SP-6]
Sequence
MSAPGSINREAPARPIRSAAQKLARATLLAAALCGLTACQSLTPSTPVAGAQFAGRLGVK
VDGDEQRSFSASFELRGDAHHGWMALSNPLGTQIGRAEWAPRQSVRLLGSDGLRQYDSLD
AMAEDLMGQALPIAALFDWLDGRPWSAAAHSPLADAGRVGFRQLGWDVQLERQQDGLIVA
VREQPSPRVTVRAKLDTP
Download sequence
Identical sequences B1Y3P7
gi|171060166|ref|YP_001792515.1| WP_012348497.1.27902 395495.Lcho_3496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]