SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060214|ref|YP_001792563.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060214|ref|YP_001792563.1|
Domain Number 1 Region: 157-315
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.69e-42
Family GGDEF domain 0.0000539
Further Details:      
 
Domain Number 2 Region: 16-147
Classification Level Classification E-value
Superfamily CheY-like 9.11e-40
Family CheY-related 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060214|ref|YP_001792563.1|
Sequence length 322
Comment response regulator receiver modulated diguanylate cyclase [Leptothrix cholodnii SP-6]
Sequence
MNASEPEVAPIPRLPSDEPNRRRRLLIVDDQPINIQALYQVFAADHQVFMATSGPQALAL
CLSKQPDLVLLDVMMPGMDGFEVCRRLKADPATADIPVIFVTAHSDEAAETLGLDVGAVD
FISKPINPNIVRARVRTHVTLKAQSDLLRHWVYIDGLTGVHNRRYFDERLATEWGRAVRC
GTALSVILIDVDFFKPYNDHYGHQTGDDCLRRVASTLKAGLKRPGDLMARYGGEEFACLL
PETPLSGALELAHQLGQHVFDQQIAHDASLVAPVVTVSLGVCSKREDTVATVAALVREAD
AQLYIAKSRGRHQACGAELDQP
Download sequence
Identical sequences B1Y497
WP_012348545.1.27902 395495.Lcho_3544 gi|171060214|ref|YP_001792563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]