SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060259|ref|YP_001792608.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060259|ref|YP_001792608.1|
Domain Number 1 Region: 347-517
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.55e-38
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 2 Region: 542-649
Classification Level Classification E-value
Superfamily CheY-like 3.98e-22
Family CheY-related 0.0097
Further Details:      
 
Domain Number 3 Region: 153-266
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.93e-16
Family Flavin-binding PAS domain 0.056
Further Details:      
 
Domain Number 4 Region: 285-353
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000608
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 
Domain Number 5 Region: 30-141
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000136
Family Heme-binding PAS domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171060259|ref|YP_001792608.1|
Sequence length 652
Comment PAS/PAC sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MTATIPDAASDRLKRHESLQAGLDLIDQGFTLIDGDLRFVAWNEAFIRLLDFPREMVFVG
APFESFMRYNAARGEYGPGDAPAYVAERMAAARRFTPHEIERTRPNGQVLRVRGVPVPGI
GFVTLYSDITAQKAAERQIREHAALLEARVAERTAALRHSEAQLRLITDSIPALVAYVDR
TRCYRYVNRGYQEWFGLDPARPAAISAREFLGASTYEGIKGHVAQAFSGQPASFDYELTR
IDGSRIRVHTSLIPDIGADGQVAGCFELTFDNTEHLRAQELVLRAQKMEALGQLTGGLAH
DFNNLLTVIIGNLGILTEQRRDTADTAEFVAPALQAARRGAELIRRLLSFARQQPLAAVA
VNVHQALIDVARLVRRSLPESLQIEVQAQSGLWIWIDPAELETALLNLLLNARDATAGNG
RVSIRASAAELLPDAAGDRGLAPGRYVRIDVSDDGCGMDEATRSRLFDPFFTTKPPGSGT
GLGMAMVYGFVNQSGGAIDVESAPDRGTTISIWLPATDAPDDEALDVPAELPPGAQPQGL
ALLVEDDAAVRQVVRHNLLALGYAVLEAGNGAEARQMLAHAPGITLLLTDVVMPGGVDGR
DLAREARDLHHVPRVLLMSGHAPARAEAGDLPLLRKPFSAAELAAALREPRE
Download sequence
Identical sequences B1Y4E2
WP_012348590.1.27902 gi|171060259|ref|YP_001792608.1| 395495.Lcho_3589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]