SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171060368|ref|YP_001792717.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060368|ref|YP_001792717.1|
Domain Number 1 Region: 8-118
Classification Level Classification E-value
Superfamily LigA subunit of an aromatic-ring-opening dioxygenase LigAB 4.97e-39
Family LigA subunit of an aromatic-ring-opening dioxygenase LigAB 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171060368|ref|YP_001792717.1|
Sequence length 120
Comment protocatechuate 4,5-dioxygenase subunit alpha [Leptothrix cholodnii SP-6]
Sequence
MSTPLRESGHIDIPGTIIFDGAQAMKGYALNKMCFSFNDAANRTAFLADEDGYCARYGLN
GQQREAIRNRNVLQLLAAGGNAYYLAKFAGIFGLDMQDIGAQQTGMTKDEFKARLLAARG
Download sequence
Identical sequences B1Y5Q6
WP_012348699.1.27902 gi|171060368|ref|YP_001792717.1| 395495.Lcho_3698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]