SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060372|ref|YP_001792721.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060372|ref|YP_001792721.1|
Domain Number 1 Region: 595-842
Classification Level Classification E-value
Superfamily EAL domain-like 2.09e-92
Family EAL domain 0.0021
Further Details:      
 
Domain Number 2 Region: 423-581
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.98e-43
Family GGDEF domain 0.00017
Further Details:      
 
Domain Number 3 Region: 7-136
Classification Level Classification E-value
Superfamily CheY-like 1.42e-37
Family CheY-related 0.0004
Further Details:      
 
Domain Number 4 Region: 149-286
Classification Level Classification E-value
Superfamily CheY-like 5.69e-37
Family CheY-related 0.00053
Further Details:      
 
Domain Number 5 Region: 297-410
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-19
Family Flavin-binding PAS domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060372|ref|YP_001792721.1|
Sequence length 863
Comment response regulator receiver modulated PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Leptothrix cholodnii SP-6]
Sequence
MTDTAAPRARILIVDDVPENLHALMNILRSDHAIVAATSGEKALALARAQPQPDMILLDI
KMPGMDGYSVLSHLKADPATAAIPVIFVTALTEAADEARGLKLGVADYITKPVNPDLLRL
RIATQLELRRHRRHPLQAEIACARAGTRRPTLLVVDDVPDNIHELIEALRDEYRITVASS
GPKALQIVQGDDPPDLVLLDIVMPDMDGYEVCRRIKALPLGPRLPVIFVTVVDASEKKVQ
GFGLGAADYITKPFDIDEVRARVRTHIELSRLQRCLEELVAQRTALLEKSEEKYRILAEY
SPNWEYWVAPDGSHLYVSPACGDVSGYSPADFFADPALMASIIHPDDRTQWAAQQARAVP
GEASATVLRIRTRDGGERWLEHVVKPVFSPAGQLLGLRGSYGDITQRRQAEQQLDYVTHR
DALTGLPNRALFTEFLDQAVQKAAHSRGEFSLLFINLDGFKTINESLGRSAGDQLLIEVA
RRLRELLPGVDAVARVGGDEFNVIVEHDVAGLGIDLVAQRIINALSHSYQLGAQSAYIGA
CIGIAQYPADGPAAESLLNSADAALHRAKAQGRNVLRFFSPELTIRARERLSLEADLRRA
LQQGELALHYQPQVDLRSGRIVGVEALLRWRHPQRGWIAPGAFIPLAEECGLIIELGDWV
LRAACEQIRHWSDAGVAPRQTAVNISAVQISSGGLLDTVRRTLAATGIAPDRLELEITES
FVMFERERSFKLLADLRALGVQLSIDDFGTGYSSLAYLQQLEVHKLKIDISFVRNMTRNR
GNASIVKAVIAMGHSLGLEVIAEGVEEIEQAAHLLALQCDVMQGYLVSKPLPVDDITRLL
ESFEPIVIPVDETLAIGGLKPQA
Download sequence
Identical sequences B1Y5R0
WP_012348703.1.27902 gi|171060372|ref|YP_001792721.1| 395495.Lcho_3702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]