SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060373|ref|YP_001792722.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060373|ref|YP_001792722.1|
Domain Number 1 Region: 324-498
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.73e-46
Family Histidine kinase 0.00043
Further Details:      
 
Domain Number 2 Region: 670-799
Classification Level Classification E-value
Superfamily CheY-like 2.85e-38
Family CheY-related 0.0016
Further Details:      
 
Domain Number 3 Region: 519-649
Classification Level Classification E-value
Superfamily CheY-like 1.57e-33
Family CheY-related 0.056
Further Details:      
 
Domain Number 4 Region: 255-336
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 
Domain Number 5 Region: 771-784,821-907
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.00000000000131
Family Aerobic respiration control sensor protein, ArcB 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060373|ref|YP_001792722.1|
Sequence length 1021
Comment Hpt sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MTGRQTLARRLLYSMLPWYLLLSLTVTGVQMAIQTVTVRAAIVDDLASLGRTVEPGITDA
VWELDIPRLAALSRGVRQNAIVTAVQVRSDNGALLVSDGELPDAAALPAGPGGVSAAHAW
QTVPLARAVSTRPARLIGHLHLYSGPQVLWDRTKYGLLVVLLNSIVVTTGLWLMFSWTVR
HRLSKEVTRMARTVAGWRYRKDETTPVEAIAYPYPDELGALVDALNDSQARLHDSMRRLD
ALNQNLEHSVAERTVELQRATDVAEAASRAKGEFLANMSHEIRTPINAILGMLYLALKSD
LAPSVRNYLGKAQNAAHALLGVINDILDLSKIEAGKLDIERVEFRLDGVLEMLTDAVGHQ
AAHKGIEFLIRYDPAIPPALIGDPLRLGQVLLNLCGNAVKFTEHGEVELAFRALPSRPGE
ITVQVNVRDTGIGIAPEVQHRLFEKFSQADQSTTRRFGGTGLGLAISKQLVELMGGRIWI
EDTLPGRGTTMCFTLPLRIAAESRAHRLDRVEQVGPLLKGVRVLVVDDNDVSREIMAEML
RYFQLDVGVAAGGEAALAALRAATEHPYDLVLMDWRMPGMNGDEVTQRLHVDPQIRSQPK
VVMVTVHGREQVVRLAEQAGVDGFLIKPVSPSTLLDTLLSVLGRGRLFGSTDAAGPAVPS
AGAGQLAGAQLLLVEDNDINREFASEFLRSEGIEVDEAVDGAQALERVQQQAYDAVLMDI
QMPVMDGLEAARAIRALGAQPGHERLATLPIIAMTALAMAQDAQRSRAAGMNDHVTKPIA
PDRLLSVLTRWVQLPAGRRGRMPLPAAASAPALPADLAALASLDAHEGVRRIGGKVEAYR
RQLRRFRENHADAVVELRRLLERDDEVAAETACHALTGVAGNIGAVALHQLLVEVDAQLK
RRIRPDAPMLDRLEAALRQVHADIDALAQPGAGVPVAPHQALSRAAIVERLDRLAQALSH
DLGDADEPLSELRAALTGDENEAAIREIAAKADVFEIDEALALVNALRERLSTPSLTQPE
P
Download sequence
Identical sequences B1Y5R1
395495.Lcho_3703 gi|171060373|ref|YP_001792722.1| WP_012348704.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]