SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060405|ref|YP_001792754.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060405|ref|YP_001792754.1|
Domain Number 1 Region: 160-384
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-59
Family Extended AAA-ATPase domain 0.00000833
Further Details:      
 
Domain Number 2 Region: 17-204
Classification Level Classification E-value
Superfamily CheY-like 3.56e-37
Family CheY-related 0.00096
Further Details:      
 
Domain Number 3 Region: 366-456
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000194
Family FIS-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060405|ref|YP_001792754.1|
Sequence length 459
Comment two component sigma-54 specific Fis family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MNAPDPTLSTHADEHWPRASVLVVDDEPGMRHFLEKALAPRVGQVFTAGSAEEAELLLQQ
HRIDLVLLDIALPGKNGIALLKDMRAQGIGAEVVLITAFADLETAIEALRAGAGDMLLKP
FRVTQALGAVRHGLERAQLRRENWVLRRTLSQRTPPADGLVGQSIVVKGLQAALRRVATV
DSTVLLTGESGTGKELAALALHHLSPHAAGPFVPVNCATTAPEQLEAELFGHSGRGPGRE
GLLIDAQGGTIFFDEVAELPLALQATLLRVLEDRRVRPVGSDRAIPIDVRIIAATNRPLI
DDVRSGRFRADLFYRLQVVEIKLPPLRAHKEDIPDLVAHFIDTLAPRLGVPPIEVTADEM
GYLRQYDWPGNVRELRNLLERSLIVGALNVSALYQSLPRPAPSRPAPAPAAAPTDLHTLE
KRHILAVLESVGGDKTQAAQLLGISRRTLERRVAEWSQA
Download sequence
Identical sequences B1Y5U3
395495.Lcho_3735 WP_012348736.1.27902 gi|171060405|ref|YP_001792754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]