SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060464|ref|YP_001792813.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060464|ref|YP_001792813.1|
Domain Number 1 Region: 1770-1972
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-19
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 216-315,357-397
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000000000000226
Family Multidomain cupredoxins 0.00043
Further Details:      
 
Domain Number 3 Region: 428-461,520-555,623-652
Classification Level Classification E-value
Superfamily Cupredoxins 0.0000000000000413
Family Multidomain cupredoxins 0.0051
Further Details:      
 
Domain Number 4 Region: 1120-1198,1246-1266
Classification Level Classification E-value
Superfamily Cupredoxins 0.0000000000000732
Family Multidomain cupredoxins 0.0011
Further Details:      
 
Domain Number 5 Region: 1273-1457
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000126
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number 6 Region: 1664-1765
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000133
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number 7 Region: 1438-1562
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000133
Family Fibronectin type III 0.0087
Further Details:      
 
Weak hits

Sequence:  gi|171060464|ref|YP_001792813.1|
Domain Number - Region: 1559-1663
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0285
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171060464|ref|YP_001792813.1|
Sequence length 1973
Comment fibronectin type III domain-containing protein [Leptothrix cholodnii SP-6]
Sequence
MRKSTRFIRTPIAAATSVLAVLLGTGLTAQAGVGFGESQDFSGNPVSNIRSHFAHSPRGD
RESANPTAADEAARLFGAGKLMGASAVDTGRALRKFVDPLPLPGQPQTMADGTVRYLPVA
APTKWINPQTGQPTGDDYFEVAVIEYKQKLHSDLKNPTTIRGYVQLSTAAVPGKQVPLFY
PDGVTPILVQETDARGFLVFNTDGSRKMVQARAVDDPHFLGPVIQARQGVPTRLKFINLL
PFGRAELGAPDADGKPVVTARNGDIFLPLDKSIAGSGLGPDGFTEYTQNRANIHLHGGDT
PWISDGTPHQWIAPAEEANAANGRGLAAQSIDPEFLPSFLRGPGAINVPDMPDPGPGAMT
YYFPNGQSGRMLWYHDHSIGMTRLNVYAGMASAYLLGDAVQDALISGGSATVNGKSATFQ
AVLPPAADTIPLVMQDRTFVPADVALQDARWNTSAWGAESDSWFPHVYETVQDPNQLNGF
NAVGRWHWGPWFWPVFPALYDLPSGEYGDVTVTPEAWMDTAMVNGVAYPTLDVDPKTYRF
QILNASNDRSMSFNLFVADDAQPFTDPVTGDVRLTEVKMVDAVIPADLCSGDQTRAVQPD
GSICTPATWPTDGRAGGVPSPASQGPTLYQIGSEGGLLPQVAVIDPVPVNYNYDRGRITV
LNVQTPALLLGNAERADVVVDFSQYAGKTLIVYSDSPAPMPAGDPRNDYFTNVGDQSTEG
GAENTKPGYGPNTRTFMRIKVRAAAPAPALDVAALKAEIPKAYALSQETPVVGQKEYNTA
FGTSWTDSGAYADIYAGSLKQPLFKYTPGTPNGGGFNSVKVTQIGSGYVSAPTVTFADST
VGNEVGAKAQATLKMSAITVTDPGAGYVSAPIVSIVAQSGGGSGAVAEARLAIDKITITN
GGAGYTSAPAVRFSVPPTGGVQASGTAIVTNGRVTGVTLDNPGSGYVGAPTVSFQGGGAT
TTARATATGKISDVKLLSLDPMNPIVYNADGSIASLGAAGGGGYTDMSQVLINFNGGVAP
AGGRAAIASASGSLFDVTMVNHGVNYTANTTIAFSGGGGSGAAAQVDTLNGGTATGSNLV
KTKAIHELFEPTFGRMNAILAVEIPFTSALTQTTIPLAMIDAPTERFADGETQIWKITHN
GVDTHPVHFHLLNVQLINRVGWDGWIDPPAPNELGWKETIRMNPLEDVIVAVRAKRPPLP
GFGVPNSIRPMDPSQPIGSPYGFTQIDPNTGTPLSVVNEVMNYGWEYVWHCHILGHEEND
FMRPIVFDANEAVPTAPGALTASANGSGSGVLLGWSDTSATEYQFRVLRATGAAGTVFTP
IGTALANGGSYLDNTAQPGTSYRYQVVAVGANGEAASGIADITTPTGAPVVPAAVQATQL
SADSVRLQWLDQSTDEAGFAVEVSVNGGAFAALTTVGSSAANVTATGITVTFDNAGAAVG
STYTYRVAAVNASGAASAYVNSNTVTVMGPPAAPNTLTAIVNSKTQVALNWIDGSTDESQ
FVIEASVNGGAFAAVSTLATPSAGASGGAVTTNVAVVNGNTYVFRVAASNTWGSSTYATS
ASVPVMIAPNAPTAQTVSVAGAAVTLNWLDNATDETSFVVEGSLNGGAYATVATVTRTAA
QATDSATPVSTSVTAAAGTWTYRVRAIGAGGASANSDWANSVTVTATGPAAPTTLTAVLQ
SSTRVRLSWVDASTNETSFLIQQSVNGGAFTQIGTVNRSAAQGAASGGVLSSQPTVAAGN
TYVFRVIARNASGSSAPADVTITVAVAPAANLAVAAVSATSARLSWTDGGPLETGYRVER
STDGVNWTVLSTTAANATGYTATGLTTGTTYQFRVTAVRTSGGVTTTATPVEVSYTVVAP
PVPTAPSALAVNATAQRSVTLGWVDNANNETSYRVEACLGTCTDASTWVLAATSTASATQ
QTGTGARTLTVSRISANGNNRLAAATTYSFRVVAVGASGNSGVSNIVTATTLP
Download sequence
Identical sequences B1Y6M0
WP_012348795.1.27902 gi|171060464|ref|YP_001792813.1| 395495.Lcho_3794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]