SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060471|ref|YP_001792820.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060471|ref|YP_001792820.1|
Domain Number 1 Region: 162-346
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.31e-68
Family Methylesterase CheB, C-terminal domain 0.000000686
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.08e-25
Family CheY-related 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171060471|ref|YP_001792820.1|
Sequence length 350
Comment chemotaxis-specific methylesterase [Leptothrix cholodnii SP-6]
Sequence
MSRIQVMVVDDSAVVRQVVAALLADDPEIEVLCAVADPLLAISRMQTQWPDVIVLDIEMP
RMDGITFLKKIMAERPTPVVICSTLTEAGTQTALAALAAGAVAIITKPRLGLKQFLQDAS
DDLLSAVKTAARANVRRLSVSAKNTADVILPAVERSSAMLQTTERVVALGTSTGGTQALE
VVLRTLPRVCPGIVIVQHMPEKFTAAFAARLDSVCQIAVREAQNNDRVVPGQALIAPGGK
HMLLRRNGAQYHVEVLDGPLVNRHRPSVDVLLRSVARSAGANALGVVMTGMGDDGAAGLL
EMRKAGARTLAQDEASCVVYGMPKEAVKRGGVERSVPLGAIGREIMLQLA
Download sequence
Identical sequences B1Y6M7
gi|171060471|ref|YP_001792820.1| WP_012348802.1.27902 395495.Lcho_3801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]