SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060488|ref|YP_001792837.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060488|ref|YP_001792837.1|
Domain Number 1 Region: 126-151,182-315
Classification Level Classification E-value
Superfamily Cupredoxins 9.84e-48
Family Periplasmic domain of cytochrome c oxidase subunit II 0.0000489
Further Details:      
 
Domain Number 2 Region: 36-123
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 2.29e-23
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.0012
Further Details:      
 
Domain Number 3 Region: 277-380
Classification Level Classification E-value
Superfamily Cytochrome c 6.85e-23
Family monodomain cytochrome c 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060488|ref|YP_001792837.1|
Sequence length 388
Comment cytochrome c oxidase subunit II [Leptothrix cholodnii SP-6]
Sequence
MNALWRHAGQVSLAVGASLAVQAAHAVNDLPGGPGVRQLDLPVGASKMSADLHSLHWIMM
VICTVIFLAVFGVMFYSIIKHRKSKGHKPANFHESVAVEIAWTIVPFVIVIGMGAMATKT
VVAQKDTTNADLTIKATGYQWKWGYDYLKGEGEGIAFLSTLDTSHRAMSDSGKPEAIDNY
LLKVDNPLVVPVDKKIRIITTADDVIHAFMVPQFGIKQDAIPGFVRDTWFRADKVGDFYG
QCAELCGKEHAYMPIHVKVLSAVDYSAWVDGEKKKLAALADDPAKVWKLDELVARGEKVY
AANCAACHQANGKGAGPIKAVDGSPVVLDADKTRQIAVLLNGQNNGAMPAWKQLSDTEIA
AVITYTKNNWSNKTGQIVQPADVVAARK
Download sequence
Identical sequences B1Y6P4
gi|171060488|ref|YP_001792837.1| WP_012348819.1.27902 395495.Lcho_3818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]