SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060593|ref|YP_001792942.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060593|ref|YP_001792942.1|
Domain Number 1 Region: 50-174
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.32e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000152
Further Details:      
 
Domain Number 2 Region: 5-50,175-229
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 5.69e-30
Family RNA polymerase alpha subunit dimerisation domain 0.00027
Further Details:      
 
Domain Number 3 Region: 250-323
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 8.11e-26
Family C-terminal domain of RNA polymerase alpha subunit 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171060593|ref|YP_001792942.1|
Sequence length 328
Comment DNA-directed RNA polymerase subunit alpha [Leptothrix cholodnii SP-6]
Sequence
MQTNLLKPKAINVDPLGGHRAKVTLEPFERGFGHTLGNALRRVLLSSMVGYAPTEVTIAG
VLHEYSTVDGVQEDVVHIMLNLKGVVFRLHNRDEVTLVLRKEGEGPVKASDIQTPHDVEI
INPDHVIAHLAQGGKLDMQIKVEKGRGYVPGSMRRYADEPTKSIGRIVLDASFSPLKRVS
YTVESARVEQRTDLDKLVMEIETNGAISPEEAIRASAKILVEQLAVFAQLEGSDLAIFEA
PAPRAQHFDPILLRPVDELELTVRSANCLKAENIYYIGDLIQRTETELLKTPNLGRKSLN
EIKEVLASRGLTLGARLENWPPQGLDKR
Download sequence
Identical sequences B1Y7M9
395495.Lcho_3923 gi|171060593|ref|YP_001792942.1| WP_012348923.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]