SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060670|ref|YP_001793019.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060670|ref|YP_001793019.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily CheY-like 7.26e-37
Family CheY-related 0.00076
Further Details:      
 
Domain Number 2 Region: 168-230
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000394
Family FIS-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171060670|ref|YP_001793019.1|
Sequence length 240
Comment two component Fis family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MANILVVDDEMGIRALLQEILTDEGHFVELAENAVQARAARERLRPDLVLLDIWMPDVDG
ITLLKEWGTTAQLGMPVIMMSGHGTIDTAVEATKYGAMAFLEKPITLQKLLRAVEQGLAK
PVPPPQRSMAPLAATMPAPVPMRNDRDYRSIDLQPMLNSVPQPVISVLSSGPQSDQNFSL
DRPLREARDAFEKAYFEFHLARENGSMTRVAERTGLERTHLYRKLKQLGVDLSRNKRGGN
Download sequence
Identical sequences B1Y8I8
395495.Lcho_4000 WP_012348999.1.27902 gi|171060670|ref|YP_001793019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]