SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060785|ref|YP_001793134.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060785|ref|YP_001793134.1|
Domain Number 1 Region: 146-391
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.74e-68
Family Extended AAA-ATPase domain 0.00000279
Further Details:      
 
Domain Number 2 Region: 1-187
Classification Level Classification E-value
Superfamily CheY-like 9.25e-44
Family CheY-related 0.0009
Further Details:      
 
Domain Number 3 Region: 361-459
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000717
Family FIS-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171060785|ref|YP_001793134.1|
Sequence length 465
Comment two component sigma-54 specific Fis family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence
MSDLNVLVVDDEPAVRQVLSAAIGKAGYPVEMAGSAAEALAKLDKTPFDVVLSDVFMPIT
DGIELLRQARTRGHNATFIMVTAFSSVDSAIDAIKAGAWDYITKPVRNEEIVHRLEQIDA
LRGLREENRALRSLVLGGGQPAFQFNSPAMQATERLISRVAPTDSTVLISGESGTGKGVT
ARRIHELSPRRDGPFVAVNCGAIPENLIESELFGHTKGAFTSADRARRGLFMQADRGTIF
LDEIGELPLSMQTKLLHVIEAKEVRPLGAEQSRKVDVRIIAATNRDLPAFVAQGRFREDL
FFRLSVFQIGMPALRERRADIPGLMRHLMAQRELPSGSGASAGQALTIDPEAEDMLIAFS
WPGNVRQLENVLHRAAILADGGCIHAADLPPEVSRVPALGPASAPSAEASECSLRERVRR
FEVSLIRRAIEEAGGDRRLAAQRLGIGLSSLYRKLDEFGADPAAG
Download sequence
Identical sequences B1XXQ0
gi|171060785|ref|YP_001793134.1| 395495.Lcho_4117 WP_012349112.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]