SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171060877|ref|YP_001793226.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060877|ref|YP_001793226.1|
Domain Number 1 Region: 534-703
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-43
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 746-865
Classification Level Classification E-value
Superfamily CheY-like 2.42e-38
Family CheY-related 0.0017
Further Details:      
 
Domain Number 3 Region: 466-546
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.1e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 4 Region: 843-856,920-1014
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 3.53e-18
Family Phosphorelay protein luxU 0.072
Further Details:      
 
Domain Number 5 Region: 315-440
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000262
Family Heme-binding PAS domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060877|ref|YP_001793226.1|
Sequence length 1110
Comment multi-sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
Sequence
MSLHTWVTRLIWLCMAPLLLLAAYLAIDRVRGVQAERDLVAENLSQELAASIDQGLQARI
GALQMLAQSPLADDPSRWRELYQEAQGFRQSFGSHVVLADRSLRMRFTTRSPFGAELPML
PRPKGQAAAPKALETGLPAVGDTFIGPIAKAPLVAIAVPALRGGQVTALLLTTFEASQYQ
AQLDQVRLPAHWSLSLLDGKGDVIARRAPAEPPAQRVVDAEGRFAVRSAVAPWSVVLEIP
RDVYRAPLQAAALTLAIAILGASLAGVLGGMLASRRLGRAVDSLAQPPQPGTPPSSIREI
AAARQLIDETARRSQAAQDSLRDSERRFRRLFQEAPLPLALVSRDARVTDINRRFVQLFG
YTLAEIPTLAHWWQLAYPDATYRAAVIARWNAARVAVAQTRGDIAPQEYHVTCRDGSVRT
LLIAGIDQDDGFMATFFDITEIRRAEQHVRALNADLERRVADRTGELLQAREAAEAANRA
KSAFLANMSHEIRTPMNAIVGLAHLLRRDAHEPVAAQRLGQMIDAAGHLLQVINDILDLS
KIEAGKLQLEQLPFSLQALLARNCALVADRARAKGLAVAIEVDGVPDALSGDPTRLSQAL
LNLLGNAVKFTEQGSIVLRAECVARGTDDHLTVRFRVRDTGIGIAPDKLDQLFAPFMQAD
ASTTRRFGGTGLGLAITQRLAATMGGEVGVRSEPGRGSEFWFTAQLREGAAARPAGAAVE
ALTHPFGDSFADPREALERLRSCCAGARLLLVEDNPVNQDVALELLRAAGFAVDVASNGV
EALAQVHGRSHDLILMDMQMPEMDGLEATRLIRALPGCATVPILAMTANAFGDDRAACLA
AGMNDHIAKPVDPAHLYAVLLRWLSGAAGGPPQAVAPGVAAAAAPAVAPTATQPAAVEPP
RHAAVDVDDLDDLDGLPRIPGLDARQAMNYVQGRVEVYRRVLRQFAYHYGDDWTELAQQL
VHGDFKALGRTAHALKSAAESIGAGRLAQLAEALEAAVASNASADALAVAAEAMHEELAF
LVAGIRTSTLGDETLPAPLAGTAMSSRDLDRLEALLAAGDYEAVALFRELRLPMRQQFST
PLGDVESSLRIFDFDAALAALRAVRAAGRI
Download sequence
Identical sequences B1XYM5
395495.Lcho_4210 gi|171060877|ref|YP_001793226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]