SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171061051|ref|YP_001793400.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171061051|ref|YP_001793400.1|
Domain Number 1 Region: 135-234,403-479
Classification Level Classification E-value
Superfamily TrmE connector domain 1.7e-48
Family TrmE connector domain 0.00094
Further Details:      
 
Domain Number 2 Region: 73-184,218-396
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-44
Family G proteins 0.0000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171061051|ref|YP_001793400.1|
Sequence length 479
Comment tRNA modification GTPase TrmE [Leptothrix cholodnii SP-6]
Sequence
MLPRHHEPIAAIATAPGRGAVGIVRVSGRGLTALATALVGRPLRPRVASYGPFLDRQGGA
IDRGLALHFPAPHSYTGEDVLELQAHGGPVVLQLLLARCLEAAGEIGTDGRPRLPGLRLA
QPGEFTERAYLNDKLDLAQAEAVADLIDASTEAAARSAARSLSGDFSRQITHLRDGLIEL
RALVEATLDFPEEEIDFLQRADAHGRLARLAERLAGLLDTARQGALLREGLRVVIAGQPN
AGKSSLLNALAGAELAIVTPIPGTTRDKISETIQIEGVPVHVIDTAGLRSDEQAGDEVER
IGISRSWQAIAEADAVLLLHDLTREHEPAYSAADTAIAQRLPADVGLIHVHNKADAAPEQ
AARVAARLAARQAGDAAGVVLSARTHDGIDALRAALLARAGWHAAPEGVFIARERHVRAL
RAAATHVTAAQGWAEQSDSALDLLAEELRSAHDALAEITGSYSSDDLLGDIFGRFCIGK
Download sequence
Identical sequences B1Y0F6
395495.Lcho_4384 gi|171061051|ref|YP_001793400.1| WP_012349376.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]